← Cockpit
SPC_011predictionSpacelunar-factories-500-1000TW

Lunar-surface factories leveraging local resources will manufacture satellites and deploy them directly into deep space via electromagnetic mass drivers — scaling to 500-1000 Terawatts/year of AI data centers in space, allowing humanity to 'meaningfull...

Predictor: Elon Musk

Prior probability
5.0%
Current probability
5.0%
evolves via intake + LBP
Conviction
5/5
Signal quality
B
Resolution
pending
Window
2040-01-01 – 2060-10-31
Edges in / out
4 / 0
Tickers exposed
29

Prediction text

Lunar-surface factories leveraging local resources will manufacture satellites and deploy them directly into deep space via electromagnetic mass drivers — scaling to 500-1000 Terawatts/year of AI data centers in space, allowing humanity to 'meaningfully ascend the Kardashev scale' and harness a non-trivial percentage of total solar output. | First functional lunar ISRU factory

Key catalyst: First functional lunar ISRU factory

Watch events: First lunar manufacturing demo; first orbital DC MW-scale

Resolution evidence

Status: pending

Physics of beamed-solar orbital DCs theoretically feasible; 500-1000 TW exceeds current human total energy production by factor of 30-60x.

Predictor: Elon Musk

κ + Brier as of 2026-07-04
κ (discount)
0.688
Brier
0.0142
excellent
Hits / Misses
1 / 0
of 3 resolved
Hit rate
33.3%
Calibration plot (stated vs observed)

Evidence about this node from Elon Musk is multiplied by κ in /api/intake. Lower κ = less weight; floors at 0.10 (effectively silenced) and caps at 1.00 (full weight).

Reference class

Not linked

This node isn't linked to a reference class. The Bayesian update applies without outside-view blending.

Probability over time

0 prob_history rows
No probability history yet.

Milestone chain

Pre-event signals (upstream prereqs + window checkpoints) → resolution event → downstream cascades. Status/dates update from linked nodes; re-derive nightly via scripts/ops/derive_milestones.py.
Leading chain: 8 pending
  1. 2026-06-01 → 2030-12-31pendingFirst commercial space-based data center / orbital compute payload launches and operates
    How: First commercial entity (Starcloud, Lonestar, xAI, Lumen Orbit, etc.) launches and operates an orbital data-center/compute payload performing useful AI workload, public benchmarks reported
    Source: https://datacentremagazine.com/news/elon-musk-on-data-centres-in-space-after-spacex-xai-mergerconf 70%
  2. 2028-01-01 → 2035-12-31pendingTERAFAB or comparable terawatt-scale space-AI program announces 1 GW deployed milestone
    How: Tesla/SpaceX/xAI TERAFAB or comparable program publicly reports >=1 GW deployed orbital AI compute capacity (1/1000th of stated 1 TW/yr scale)
    Source: https://newspaceeconomy.ca/2026/03/22/elon-musk-unveils-terafab-tesla-spacex-xai-project-aims-for-terawatt-scale-ai-compute-with-bold-lunar-manufacturing-vision/conf 45%
  3. 2032-01-01 → 2045-12-31pendingFirst lunar surface ISRU demonstration manufactures any space-deployable component
    How: NASA Artemis, CLPS contractor, Blue Origin, or SpaceX lunar mission demonstrates manufacturing any structural or functional component on lunar surface from local regolith/ice (printable beam, oxygen tank, solar panel substrate)
    Source: https://manufacturingdigital.com/news/manufacturing-on-the-moon-inside-spacex-and-xais-plansconf 40%
  4. 2035-01-01 → 2050-12-31pendingElectromagnetic mass driver / lunar launch system: ground-test demonstration on Earth or lunar pilot
    How: Public demonstration of working electromagnetic mass-driver launching payload to escape velocity (test on Earth) OR first operational lunar mass-driver delivers payload off lunar surface to space
    Source: https://geekspin.co/elon-musk-wants-to-put-a-massive-catapult-on-the-moonconf 30%
  5. 2043-11-20pendingQ1 window check-in (25%)
  6. 2047-10-09pendingQ2 window check-in (50%)
  7. 2042-01-01 → 2058-12-31pendingCascade: Lunar-manufactured satellite first deployed to deep-space orbit
    How: First satellite/spacecraft built (substantially) from lunar-mined materials reaches operational orbit beyond lunar gravity well, validates Musk's core lunar-factory-deploys-to-deep-space thesis
    Source: https://eu.36kr.com/en/p/3567865887390593conf 30%
  8. 2051-08-28pendingQ3 window check-in (75%)

No downstream cascades — this prediction is a leaf in the dependency graph.

What if this resolves?

Clamp this prediction TRUE or FALSE and run a counterfactual Gibbs sample. Surfaces the predictions whose marginals shift most under that assumption.
(live posterior: 5%)

Click a button to clamp this prediction and run a Gibbs sample. Returns the predictions whose marginals shift most. ~30s per run; ideal for stress-testing "if X resolves, what else moves?"

Evidence chain

Every probability update with full Bayesian provenance — chronological, latest first

No probability history yet. The first evidence will arrive via /api/intake or the daily milestone sweep / weekly LBP run.

Network propagation neighbors

Top edges sorted by latest LBP cross-impact
All propagation →

Top incoming (parents)

Edges that influence THIS node's belief

KindNodeTheir probP(c|s=T)P(c|s=F)Δ implied
killerTK01
AGI Capability Plateau (2026-27 Training Stall)
15.0%0.0500.050+0.000
killerTK03
AI Regulatory Moratorium (EU/US Capability Freeze)
10.0%0.0500.050+0.000
killerTK09
Energy Grid Cap (Data Center Power Wall)
35.0%0.0500.050+0.000
killerTK15
SpaceX Starship Catastrophic Failure
12.0%0.0500.050+0.000

Top outgoing (children)

Predictions THIS node influences

No outgoing edges.

Ticker exposure

29 ticker(s) linked

Beneficiaries (21)

NXTSTEMARRYFSLRDQGWHJKSEOSEMVSTFLNCQSSHLSPCRFYLMTNRGIFNNYTSLABYDDYONNEEBA

Prerequisites (4)

Predictions that must hit first
TypePredTitleDomainLag
killerTK09Energy Grid Cap (Data Center Power Wall)
killerTK01AGI Capability Plateau (2026-27 Training Stall)
killerTK15SpaceX Starship Catastrophic Failure
killerTK03AI Regulatory Moratorium (EU/US Capability Freeze)

Dependents (0)

Predictions enabled by this
TypePredTitleDomainLag
No dependents

Raw metadata

From Thesis_Timeline_v1.0_FINAL workbook
{
  "nia": false,
  "qty": "500-1000 TW/yr",
  "mode": "FORECAST",
  "role": "Cited-CEO",
  "context": "Extends 232_047 and 239_010 (mass driver moon 10yrs) with specific TW/yr quantification. Couples with 232_049 (Wissner-Gross moon disassembly Dyson swarm).",
  "to_year": 2060,
  "conv_cues": "specific TW figures; explicit Kardashev framing",
  "direction": "NUMERIC_TARGET",
  "from_year": 2040,
  "timeframe": "2040-2060",
  "conv_level": "HIGH",
  "milestones": [
    {
      "kind": "llm_pre_event",
      "label": "First commercial space-based data center / orbital compute payload launches and operates",
      "source": "https://datacentremagazine.com/news/elon-musk-on-data-centres-in-space-after-spacex-xai-merger",
      "status": "pending",
      "weight": 0.4,
      "ordinal": -8,
      "source_id": null,
      "confidence": 0.7,
      "expected_date": "2028-09-15",
      "research_origin": "training",
      "expected_date_range": {
        "to": "2030-12-31",
        "from": "2026-06-01"
      },
      "measurement_criterion": "First commercial entity (Starcloud, Lonestar, xAI, Lumen Orbit, etc.) launches and operates an orbital data-center/compute payload performing useful AI workload, public benchmarks reported"
    },
    {
      "kind": "llm_pre_event",
      "label": "TERAFAB or comparable terawatt-scale space-AI program announces 1 GW deployed milestone",
      "source": "https://newspaceeconomy.ca/2026/03/22/elon-musk-unveils-terafab-tesla-spacex-xai-project-aims-for-terawatt-scale-ai-compute-with-bold-lunar-manufacturing-vision/",
      "status": "pending",
      "weight": 0.4,
      "ordinal": -7,
      "source_id": null,
      "confidence": 0.45,
      "expected_date": "2031-12-31",
      "research_origin": "training",
      "expected_date_range": {
        "to": "2035-12-31",
        "from": "2028-01-01"
      },
      "measurement_criterion": "Tesla/SpaceX/xAI TERAFAB or comparable program publicly reports >=1 GW deployed orbital AI compute capacity (1/1000th of stated 1 TW/yr scale)"
    },
    {
      "kind": "llm_pre_event",
      "label": "First lunar surface ISRU demonstration manufactures any space-deployable component",
      "source": "https://manufacturingdigital.com/news/manufacturing-on-the-moon-inside-spacex-and-xais-plans",
      "status": "pending",
      "weight": 0.4,
      "ordinal": -6,
      "source_id": null,
      "confidence": 0.4,
      "expected_date": "2038-12-31",
      "research_origin": "training",
      "expected_date_range": {
        "to": "2045-12-31",
        "from": "2032-01-01"
      },
      "measurement_criterion": "NASA Artemis, CLPS contractor, Blue Origin, or SpaceX lunar mission demonstrates manufacturing any structural or functional component on lunar surface from local regolith/ice (printable beam, oxygen tank, solar panel substrate)"
    },
    {
      "kind": "llm_pre_event",
      "label": "Electromagnetic mass driver / lunar launch system: ground-test demonstration on Earth or lunar pilot",
      "source": "https://geekspin.co/elon-musk-wants-to-put-a-massive-catapult-on-the-moon",
      "status": "pending",
      "weight": 0.4,
      "ordinal": -5,
      "source_id": null,
      "confidence": 0.3,
      "expected_date": "2042-12-31",
      "research_origin": "training",
      "expected_date_range": {
        "to": "2050-12-31",
        "from": "2035-01-01"
      },
      "measurement_criterion": "Public demonstration of working electromagnetic mass-driver launching payload to escape velocity (test on Earth) OR first operational lunar mass-driver delivers payload off lunar surface to space"
    },
    {
      "kind": "quartile_checkpoint",
      "label": "Q1 window check-in (25%)",
      "status": "pending",
      "weight": 0.05,
      "ordinal": -4,
      "source_id": null,
      "expected_date": "2043-11-20",
      "observed_date": null
    },
    {
      "kind": "quartile_checkpoint",
      "label": "Q2 window check-in (50%)",
      "status": "pending",
     
... (truncated)