← Cockpit
CMQ_053predictionRoboticsFigure-funding

Figure AI secured $675M Series B in 2024 and partnered commercially with BMW — addressing skilled-labor shortages in automotive manufacturing.

Predictor: Brett Adcock

Prior probability
99.0%
Current probability
55.0%
evolves via intake + LBP
Conviction
5/5
Signal quality
A
Resolution
hit
Window
2024-01-01 – 2026-09-30
Edges in / out
2 / 0
Tickers exposed
22

Prediction text

Figure AI secured $675M Series B in 2024 and partnered commercially with BMW — addressing skilled-labor shortages in automotive manufacturing. | Figure Series C / second-OEM announcements

Key catalyst: Figure Series C / second-OEM announcements

Watch events: Figure Series C funding round; second OEM customer; BotQ production ramp to 12K units/yr.

Resolution evidence

Status: hit

Figure AI $675M Series B closed Feb 2024 at $2.6B post-money; BMW Spartanburg deployment expanding 2025-2026.

Predictor: Brett Adcock

κ + Brier as of 2026-07-04
κ (discount)
0.792
Brier
0.0324
excellent
Hits / Misses
6 / 0
of 7 resolved
Hit rate
85.7%
Calibration plot (stated vs observed)

Evidence about this node from Brett Adcock is multiplied by κ in /api/intake. Lower κ = less weight; floors at 0.10 (effectively silenced) and caps at 1.00 (full weight).

Reference class: humanoid_commercial_volume

Linked via embedding similarity 0.613

>10,000 unit cumulative deployment of humanoid robot SKU within 3 years of debut

Base rate
10.0%
0/3 historical
Inside weight
Outside weight
no pull
inside 55.0% → blend 55.0% 0.0pp)

Tetlock-style outside view: at TRF=1 (just predicted), outside view dominates (w_in=0.3). At TRF=0 (deadline), inside view dominates (w_in=1.0). The blend regularizes overconfident inside views toward the historical base rate.

Probability over time

7 prob_history rows
0%25%50%75%100%prior 99%2026-04-292026-05-032026-05-24
intake v2milestone miss sweeplbp propagationreference class assignedlegacy v1prior_prob (analyst seed)current = 55.0%

Milestone chain

Pre-event signals (upstream prereqs + window checkpoints) → resolution event → downstream cascades. Status/dates update from linked nodes; re-derive nightly via scripts/ops/derive_milestones.py.
Leading chain: 3 overdue ⏱
  1. 2024-07-31overdueQ1 window check-in (25%)
  2. 2025-02-28overdueQ2 window check-in (50%)
  3. 2025-09-28overdueQ3 window check-in (75%)

No downstream cascades — this prediction is a leaf in the dependency graph.

What if this resolves?

Clamp this prediction TRUE or FALSE and run a counterfactual Gibbs sample. Surfaces the predictions whose marginals shift most under that assumption.
(live posterior: 55%)

Click a button to clamp this prediction and run a Gibbs sample. Returns the predictions whose marginals shift most. ~30s per run; ideal for stress-testing "if X resolves, what else moves?"

Evidence chain

Every probability update with full Bayesian provenance — chronological, latest first
LBP2026-05-24T02:00:02Z55.0%-5.4pp
Network propagation: 60.5% → 55.0%
4-iter LBP, residual 0.01000 · damping 0.5, w_intrinsic 0.5 · method lbp_v3 · run 806b02f8
LBP2026-05-17T02:00:01Z60.5%-10.1pp
Network propagation: 70.5% → 60.5%
5-iter LBP, residual 0.00689 · damping 0.5, w_intrinsic 0.5 · method lbp_v3 · run e607fa96
LBP2026-05-10T02:00:02Z70.5%-14.9pp
Network propagation: 85.4% → 70.5%
6-iter LBP, residual 0.00584 · damping 0.5, w_intrinsic 0.5 · method lbp_v3 · run e5c18d29
LBP2026-05-03T02:00:01Z85.4%-11.7pp
Network propagation: 97.2% → 85.4%
6-iter LBP, residual 0.00677 · damping 0.5, w_intrinsic 0.5 · method lbp_v3 · run 1a683ac9
legacy v12026-04-30T16:13:50Z97.2%+0.0pp
reference_class_assigned bayesian_v2 inside=0.990 blend=0.972 w_in=0.84 humanoid_commercial_volume
legacy v12026-04-30T01:56:50Z97.2%-1.8pp
reference_class_assigned bayesian_v2 inside=0.990 blend=0.972 w_in=0.84 humanoid_commercial_volume
resolution_terminal2026-04-29T22:23:18Z100.0%+2.8pp
resolution_terminal hit outcome=1.0 pre_resolution=0.972
Raw metadata
{
  "source": "backfill_resolution_history.py",
  "status": "hit",
  "bayesian_v2": false,
  "outcome_prob": 1,
  "evidence_kind": "resolution_terminal",
  "posterior_prob": 1,
  "delta_to_outcome": 0.028349999999999986,
  "inside_posterior": 0.97165,
  "validation_notes": "Figure AI $675M Series B closed Feb 2024 at $2.6B post-money; BMW Spartanburg deployment expanding 2025-2026.",
  "validation_status": "hit",
  "pre_resolution_prob": 0.97165,
  "resolution_evidence": "Figure AI $675M Series B closed Feb 2024 at $2.6B post-money; BMW Spartanburg deployment expanding 2025-2026.",
  "does_not_update_current_prob": true
}

Network propagation neighbors

Top edges sorted by latest LBP cross-impact
All propagation →

No propagation data yet. Run inference/.venv/bin/python scripts/ops/run_loopy_belief_propagation.py on the droplet, or wait for the Sunday 02:00 UTC weekly cron.

Ticker exposure

22 ticker(s) linked

Beneficiaries (22)

USARALNTFANUYHSEHYIRBTLYSCFMPRNSHFSERVSYMMIELYTERPHTSLAAMZNBYDDYTXNSTMHYMTFIFNNYABBNYTEL

Prerequisites (2)

Predictions that must hit first
TypePredTitleDomainLag
correlateS_HUMANOID_ENTERPRISE_2028Humanoid R2: 100K+ enterprise by Nov 2028humanoid_deployment
correlateS_HUMANOID_FACTORY_2026Humanoid R1: 10K+ factory units by Nov 2026humanoid_deployment

Dependents (0)

Predictions enabled by this
TypePredTitleDomainLag
No dependents

Expected milestones (1)

From Sheet 17 Monitoring Triggers
Expected byDescriptionStatus
2026-12-31[Robotics 2026-12] [CMQ_053] Figure Series C funding round; second OEM customer; BotQ production ramp to 12K units/yr. [247_045] Figure 03 shipment volume; BMW, 2nd customer deployment count [239_033] Tesla Q2 2026 earnings; Optpending

Validations (1)

Resolution events
Observed atStatusByNotes
2026-04-29hitthesis_timeline_v1.0_importFigure AI $675M Series B closed Feb 2024 at $2.6B post-money; BMW Spartanburg deployment expanding 2025-2026.

Linked documents (10)

Auto-generated by cosine similarity from Polymarket / Manifold / EDGAR / GDELT
SimSourceTitleMarket probPolarityReviewedPublished
0.608edgar_8kAutodesk, Inc. (ADSK) (CIK 0000769397)mentionspending2026-06-15
0.608edgar_8kAutodesk, Inc. (ADSK) (CIK 0000769397)mentionspending2026-06-18
0.602polymarketWill Audi be the 2026 F1 Constructors' Champion?1%mentionspending2025-12-08
0.602polymarketWill Alpine be the 2026 F1 Constructors' Champion?1%mentionspending2025-12-08
0.584arxivAutoSpecNER: A Fine-Grained Named Entity Recognition Dataset for Vehicle Specification Extractionmentionspending2026-06-23
0.582gdeltferrari still widest moat auto 123700972.htmlmentionspending2026-04-30
0.566edgar_8kCUMMINS INC (CMI) (CIK 0000026172)mentionspending2026-05-05
0.566edgar_8kCUMMINS INC (CMI) (CIK 0000026172)mentionspending2026-05-14
0.565manifoldF1 2026 Monaco Grand Prix Pole Positionmentionspending2026-05-30
0.558edgar_8kGeneral Motors Co (GM) (CIK 0001467858)mentionspending2026-06-04

Raw metadata

From Thesis_Timeline_v1.0_FINAL workbook
{
  "nia": false,
  "qty": "$675M Series B",
  "mode": "FORECAST",
  "role": "Guest-CEO",
  "context": "Validation proof-point for humanoid commercial deployment; BMW partnership is first meaningful OEM manufacturing pilot.",
  "to_year": 2026,
  "conv_cues": "confirmed transaction",
  "direction": "HAPPEN",
  "from_year": 2024,
  "timeframe": "2024-2026",
  "conv_level": "HIGH",
  "milestones": [
    {
      "kind": "quartile_checkpoint",
      "label": "Q1 window check-in (25%)",
      "status": "overdue",
      "weight": 0.05,
      "ordinal": -3,
      "source_id": null,
      "expected_date": "2024-07-31",
      "observed_date": null,
      "miss_emitted_at": "2026-05-02T22:07:21.384228+00:00",
      "miss_emitted_by": "metadata_milestone_sweep"
    },
    {
      "kind": "quartile_checkpoint",
      "label": "Q2 window check-in (50%)",
      "status": "overdue",
      "weight": 0.05,
      "ordinal": -2,
      "source_id": null,
      "expected_date": "2025-02-28",
      "observed_date": null,
      "miss_emitted_at": "2026-05-02T22:07:21.384228+00:00",
      "miss_emitted_by": "metadata_milestone_sweep"
    },
    {
      "kind": "quartile_checkpoint",
      "label": "Q3 window check-in (75%)",
      "status": "overdue",
      "weight": 0.05,
      "ordinal": -1,
      "source_id": null,
      "expected_date": "2025-09-28",
      "observed_date": null,
      "miss_emitted_at": "2026-05-02T22:07:21.384228+00:00",
      "miss_emitted_by": "metadata_milestone_sweep"
    },
    {
      "kind": "event",
      "label": "Figure AI secured $675M Series B in 2024 and partnered commercially with BMW — addressing skilled-labor shortages in automotive manufacturin",
      "status": "hit",
      "weight": 1,
      "ordinal": 0,
      "source_id": "CMQ_053",
      "expected_date": "2026-04-29",
      "observed_date": "2026-04-29"
    }
  ],
  "repeat_eps": 1,
  "affiliation": "Figure AI",
  "attribution": "FIRST_PERSON",
  "granularity": "YEAR_RANGE",
  "resolved_at": "2026-04-29T22:23:18.121548+00:00",
  "source_refs": "36, 37",
  "target_date": "2025-06-15T00:00:00",
  "display_date": "2026-04-29",
  "episode_date": "2026-04-21T00:00:00",
  "key_catalyst": "Figure Series C / second-OEM announcements",
  "parse_method": "Report midpoint",
  "domain_bucket": "Robotics",
  "episode_title": "The Global Architecture of Machine Intelligence: Exhaustive Synthesis of AI Compute, Memory & Quantum Predictions (2023-2026)",
  "fault_line_id": "F005",
  "flag_repeated": false,
  "in_5yr_window": false,
  "source_report": "AI_Chip__Compute__Memory__Quantum_Predictions.md (2026-04-21)",
  "appears_in_eps": "CMQ-RPT",
  "futurist_phase": "Phase 1 (2026)",
  "is_macro_claim": false,
  "total_mentions": 1,
  "priority_weight": 5,
  "ps_cluster_tags": [
    "C8"
  ],
  "report_evidence": "Figure = clearest public-market proxy for humanoid commercialization arc.",
  "active_end_month": "2026-12",
  "recent_statement": "Figure 03 launch late 2025; BMW deployment scaling through 2026; second OEM customer signed 2026.",
  "watch_events_raw": "Figure Series C funding round; second OEM customer; BotQ production ramp to 12K units/yr.",
  "months_from_today": -10,
  "probability_layer": "Higher (in-flight)",
  "active_start_month": "2024-01",
  "december_dispersal": {
    "reason": "december_dispersal: domain=Robotics → 09/2026",
    "new_date": "2026-09-30",
    "old_date": "2026-12-31",
    "applied_at": "2026-04-30T16:28:34.304992+00:00"
  },
  "flag_nia_bracketed": false,
  "resolved_at_source": "validations_observed_at",
  "track_record_grade": "A",
  "track_record_notes": "All announced metrics confirmed; Figure execution tracks public roadmap.",
  "flag_near_term_2027": true,
  "flag_high_conviction": true,
  "milestones_derived_at": "2026-05-02T03:08:50.679535+00:00",
  "reference_class_match": {
    "top_n": [
      {
        "id": "humanoid_commercial_volume",
        "cosine": 0.6133
      }
    ],
    "margin": 0.6133,
    "best_id": "humanoid_c