← Cockpit
CMQ_052predictionRoboticshumanoid-economics

Humanoid robot price will drop to ~$20K-$30K per unit — leased cost ~$500/month for a 24/7 robotic laborer, fundamentally altering physical-labor economics.

Predictor: Brett Adcock

Prior probability
45.0%
Current probability
22.1%
evolves via intake + LBP
Conviction
5/5
Signal quality
A
Resolution
pending
Window
2026-01-01 – 2026-11-30
Edges in / out
2 / 0
Tickers exposed
25

Prediction text

Humanoid robot price will drop to ~$20K-$30K per unit — leased cost ~$500/month for a 24/7 robotic laborer, fundamentally altering physical-labor economics. | Humanoid commercial pricing announcements

Key catalyst: Humanoid commercial pricing announcements

Watch events: Humanoid BOM disclosures; commercial lease/purchase pricing; Tesla Optimus MSRP announcements.

Resolution evidence

Status: pending

Figure 02/03 current BOM ~$70-100K; Tesla Optimus targeting $20-30K initial price; scale economics assumed.

Predictor: Brett Adcock

κ + Brier as of 2026-07-04
κ (discount)
0.792
Brier
0.0324
excellent
Hits / Misses
6 / 0
of 7 resolved
Hit rate
85.7%
Calibration plot (stated vs observed)

Evidence about this node from Brett Adcock is multiplied by κ in /api/intake. Lower κ = less weight; floors at 0.10 (effectively silenced) and caps at 1.00 (full weight).

Reference class: humanoid_commercial_volume

Linked via embedding similarity 0.701

>10,000 unit cumulative deployment of humanoid robot SKU within 3 years of debut

Base rate
10.0%
0/3 historical
Inside weight
0.615
TRF=0.55
Outside weight
0.385
pulling toward base rate
inside 33.9% → blend 22.1% -11.7pp)

Tetlock-style outside view: at TRF=1 (just predicted), outside view dominates (w_in=0.3). At TRF=0 (deadline), inside view dominates (w_in=1.0). The blend regularizes overconfident inside views toward the historical base rate.

Probability over time

9 prob_history rows
0%25%50%75%100%prior 45%2026-04-302026-05-102026-05-30
intake v2milestone miss sweeplbp propagationreference class assignedlegacy v1prior_prob (analyst seed)current = 22.1%

Milestone chain

Pre-event signals (upstream prereqs + window checkpoints) → resolution event → downstream cascades. Status/dates update from linked nodes; re-derive nightly via scripts/ops/derive_milestones.py.
Leading chain: 2 overdue ⏱ · 1 pending
  1. 2026-03-10overdueQ1 window check-in (25%)
  2. 2026-05-18overdueQ2 window check-in (50%)
  3. 2026-07-26pendingQ3 window check-in (75%)

No downstream cascades — this prediction is a leaf in the dependency graph.

What if this resolves?

Clamp this prediction TRUE or FALSE and run a counterfactual Gibbs sample. Surfaces the predictions whose marginals shift most under that assumption.
(live posterior: 22%)

Click a button to clamp this prediction and run a Gibbs sample. Returns the predictions whose marginals shift most. ~30s per run; ideal for stress-testing "if X resolves, what else moves?"

Evidence chain

Every probability update with full Bayesian provenance — chronological, latest first
metadata_milestone_miss_sweep2026-05-30T22:15:00Z22.1%-19.0pp
metadata_milestone_miss_sweep bayesian_v2 n=1 inside=0.339 blend=0.221 LLR=-0.313 κ=0.77 w_in=0.62 humanoid_commercial_volume
Raw metadata
{
  "trf": 0.5497684922277138,
  "kappa": 0.7727,
  "base_rate": 0.1,
  "predictor": "Brett Adcock",
  "total_llr": -0.4054651081081644,
  "grace_days": 7,
  "bayesian_v2": true,
  "prior_logit": -0.3563560001041845,
  "bayes_factor": "1.4:1 against",
  "blend_reason": "blend 61% inside / 38% outside (TRF=0.550, base_rate=0.100 from humanoid_commercial_volume)",
  "inside_prior": 0.4118419608877138,
  "kappa_source": "predictor_table",
  "n_milestones": 1,
  "blend_applied": true,
  "contributions": [
    {
      "llr": -0.4054651081081644,
      "kind": "quartile_checkpoint",
      "kappa": 0.7727,
      "label": "Q2 window check-in (50%)",
      "weight": 0.05,
      "strength": "weak",
      "confidence": null,
      "source_url": null,
      "adjusted_llr": -0.31330288903517867,
      "expected_date": "2026-05-18",
      "measurement_criterion": null
    }
  ],
  "evidence_kind": "metadata_milestone_miss_sweep",
  "inside_source": "history_v2",
  "inside_weight": 0.6151620554406003,
  "outside_weight": 0.3848379445593997,
  "posterior_prob": 0.22140039408926465,
  "posterior_logit": -0.6696588891393631,
  "predictor_brier": 0.00405,
  "inside_posterior": 0.338573225432707,
  "blended_posterior": 0.22140039408926465,
  "reference_class_id": "humanoid_commercial_volume",
  "total_adjusted_llr": -0.31330288903517867,
  "predictor_n_resolved": 6
}
LBP2026-05-24T02:00:02Z41.2%+1.1pp
Network propagation: 40.1% → 41.2%
4-iter LBP, residual 0.01000 · damping 0.5, w_intrinsic 0.5 · method lbp_v3 · run 806b02f8
intake_event_update2026-05-21T23:15:16Z40.1%+0.7pp
intake:7afeeb9a-f217-4dd2-b910-24ff14bdfc39 bayesian_v2 inside=0.693 blend=0.401 LLR=1.244 κ=0.77 w_in=0.60 humanoid_commercial_volume
Raw metadata
{
  "trf": 0.5766698637873985,
  "kappa": 0.7727,
  "base_rate": 0.1,
  "predictor": "Brett Adcock",
  "total_llr": 1.6094379124341,
  "bayesian_v2": true,
  "prior_logit": -0.4312560101714709,
  "bayes_factor": "3.5:1 favoring",
  "blend_reason": "blend 60% inside / 40% outside (TRF=0.577, base_rate=0.100 from humanoid_commercial_volume)",
  "inside_prior": 0.3938264478543537,
  "kappa_source": "predictor_table",
  "blend_applied": true,
  "contributions": [
    {
      "llr": 1.6094379124341,
      "kappa": 0.7727,
      "label": "1X NEO priced at exactly $20K + $499/mo - bullseye on Brett Adcock's price-point prediction.",
      "adjusted_llr": 1.243612674937829
    }
  ],
  "evidence_kind": "intake_event_update",
  "inside_source": "history_v2",
  "inside_weight": 0.596331095348821,
  "outside_weight": 0.403668904651179,
  "posterior_prob": 0.4007075863023042,
  "evidence_origin": "daily_intake",
  "llm_suggestions": [
    {
      "polarity": "corroborates",
      "status_change": "unchanged",
      "evidence_strength": "strong",
      "delta_prob_suggestion": 0.07
    }
  ],
  "posterior_logit": 0.8123566647663585,
  "predictor_brier": 0.00405,
  "evidence_doc_ids": [],
  "inside_posterior": 0.6926114677881242,
  "blended_posterior": 0.4007075863023042,
  "reference_class_id": "humanoid_commercial_volume",
  "total_adjusted_llr": 1.243612674937829,
  "predictor_n_resolved": 6
}
LBP2026-05-17T02:00:01Z39.4%+2.8pp
Network propagation: 36.6% → 39.4%
5-iter LBP, residual 0.00689 · damping 0.5, w_intrinsic 0.5 · method lbp_v3 · run e607fa96
LBP2026-05-10T02:00:02Z36.6%+5.3pp
Network propagation: 31.2% → 36.6%
6-iter LBP, residual 0.00584 · damping 0.5, w_intrinsic 0.5 · method lbp_v3 · run e5c18d29
LBP2026-05-03T02:00:01Z31.2%+9.1pp
Network propagation: 22.1% → 31.2%
6-iter LBP, residual 0.00677 · damping 0.5, w_intrinsic 0.5 · method lbp_v3 · run 1a683ac9
metadata_milestone_miss_sweep2026-05-02T22:07:21Z22.1%-2.2pp
metadata_milestone_miss_sweep bayesian_v2 n=1 inside=0.374 blend=0.221 LLR=-0.313 κ=0.77 w_in=0.56 humanoid_commercial_volume
Raw metadata
{
  "trf": 0.6338685427014515,
  "kappa": 0.7727,
  "base_rate": 0.1,
  "predictor": "Brett Adcock",
  "total_llr": -0.4054651081081644,
  "grace_days": 7,
  "bayesian_v2": true,
  "prior_logit": -0.20067069546215124,
  "bayes_factor": "1.4:1 against",
  "blend_reason": "blend 55% inside / 44% outside (TRF=0.634, base_rate=0.100 from humanoid_commercial_volume)",
  "inside_prior": 0.45,
  "kappa_source": "predictor_table",
  "n_milestones": 1,
  "blend_applied": true,
  "contributions": [
    {
      "llr": -0.4054651081081644,
      "kind": "quartile_checkpoint",
      "kappa": 0.7727,
      "label": "Q1 window check-in (25%)",
      "weight": 0.05,
      "strength": "weak",
      "confidence": null,
      "source_url": null,
      "adjusted_llr": -0.31330288903517867,
      "expected_date": "2026-03-10",
      "measurement_criterion": null
    }
  ],
  "evidence_kind": "metadata_milestone_miss_sweep",
  "inside_source": "history_v2",
  "inside_weight": 0.5562920201089838,
  "outside_weight": 0.4437079798910162,
  "posterior_prob": 0.22082838150767423,
  "posterior_logit": -0.5139735844973299,
  "predictor_brier": 0.00405,
  "inside_posterior": 0.3742624875201742,
  "blended_posterior": 0.22082838150767423,
  "reference_class_id": "humanoid_commercial_volume",
  "total_adjusted_llr": -0.31330288903517867,
  "predictor_n_resolved": 6
}
legacy v12026-04-30T16:13:50Z24.3%+0.0pp
reference_class_assigned bayesian_v2 inside=0.450 blend=0.243 w_in=0.53 humanoid_commercial_volume
legacy v12026-04-30T01:56:50Z24.2%-20.8pp
reference_class_assigned bayesian_v2 inside=0.450 blend=0.242 w_in=0.53 humanoid_commercial_volume

Network propagation neighbors

Top edges sorted by latest LBP cross-impact
All propagation →

No propagation data yet. Run inference/.venv/bin/python scripts/ops/run_loopy_belief_propagation.py on the droplet, or wait for the Sunday 02:00 UTC weekly cron.

Ticker exposure

25 ticker(s) linked

Beneficiaries (22)

LYSCFSYMHSEHYMPALNTSERVRNSHFFANUYIRBTUSARMIELYAMZNBYDDYHYMTFIFNNYABBNYPHTERTSLATXNSTMTEL

Adverse (3)

RHIKFYMAN

Prerequisites (2)

Predictions that must hit first
TypePredTitleDomainLag
correlateS_HUMANOID_ENTERPRISE_2028Humanoid R2: 100K+ enterprise by Nov 2028humanoid_deployment
correlateS_HUMANOID_CONSUMER_2030Humanoid R3: 1M+ consumer by Nov 2030humanoid_deployment

Dependents (0)

Predictions enabled by this
TypePredTitleDomainLag
No dependents

Linked documents (2)

Auto-generated by cosine similarity from Polymarket / Manifold / EDGAR / GDELT
SimSourceTitleMarket probPolarityReviewedPublished
0.550codex_research_pack1X - NEO Factory in Hayward with Consumer Shipments Planned for 2026corroboratespending2026-04-30
0.550codex_research_pack1X - NEO's Starting to Learn On Its Owncorroboratespending2026-01-12

Raw metadata

From Thesis_Timeline_v1.0_FINAL workbook
{
  "nia": false,
  "qty": "~$20-30K / ~$500/mo",
  "mode": "FORECAST",
  "role": "Guest-CEO",
  "caveats": "Price-point assumes production scale + BOM cost curve reaches consumer-auto equivalents.",
  "context": "Economic unlock point: $500/month lease vs $3-5K/month human laborer at minimum wage + benefits.",
  "to_year": 2030,
  "conv_cues": "specific price point; CEO",
  "direction": "NUMERIC_TARGET",
  "from_year": 2026,
  "timeframe": "by 2030",
  "conv_level": "HIGH",
  "milestones": [
    {
      "kind": "quartile_checkpoint",
      "label": "Q1 window check-in (25%)",
      "status": "overdue",
      "weight": 0.05,
      "ordinal": -3,
      "source_id": null,
      "expected_date": "2026-03-10",
      "observed_date": null,
      "miss_emitted_at": "2026-05-02T22:07:21.384228+00:00",
      "miss_emitted_by": "metadata_milestone_sweep"
    },
    {
      "kind": "quartile_checkpoint",
      "label": "Q2 window check-in (50%)",
      "status": "overdue",
      "weight": 0.05,
      "ordinal": -2,
      "source_id": null,
      "expected_date": "2026-05-18",
      "observed_date": null,
      "miss_emitted_at": "2026-05-30T22:15:00.756418+00:00",
      "miss_emitted_by": "metadata_milestone_sweep"
    },
    {
      "kind": "quartile_checkpoint",
      "label": "Q3 window check-in (75%)",
      "status": "pending",
      "weight": 0.05,
      "ordinal": -1,
      "source_id": null,
      "expected_date": "2026-07-26",
      "observed_date": null
    },
    {
      "kind": "event",
      "label": "Humanoid robot price will drop to ~$20K-$30K per unit — leased cost ~$500/month for a 24/7 robotic laborer, fundamentally altering physical-",
      "status": "pending",
      "weight": 1,
      "ordinal": 0,
      "source_id": "CMQ_052",
      "expected_date": "2026-10-03",
      "observed_date": null
    }
  ],
  "repeat_eps": 1,
  "affiliation": "Figure AI",
  "attribution": "FIRST_PERSON",
  "granularity": "YEAR",
  "source_refs": "36, 37",
  "target_date": "2029-01-15T00:00:00",
  "display_date": "2026-10-03",
  "episode_date": "2026-04-21T00:00:00",
  "key_catalyst": "Humanoid commercial pricing announcements",
  "parse_method": "Report midpoint",
  "domain_bucket": "Robotics",
  "episode_title": "The Global Architecture of Machine Intelligence: Exhaustive Synthesis of AI Compute, Memory & Quantum Predictions (2023-2026)",
  "fault_line_id": "F005",
  "flag_repeated": false,
  "in_5yr_window": true,
  "source_report": "AI_Chip__Compute__Memory__Quantum_Predictions.md (2026-04-21)",
  "appears_in_eps": "CMQ-RPT",
  "futurist_phase": "Phase 3 (2029-2030)",
  "is_macro_claim": false,
  "total_mentions": 1,
  "priority_weight": 5,
  "ps_cluster_tags": [
    "C8"
  ],
  "report_evidence": "$500/mo unit economics = the trigger for mass deployment in manufacturing, logistics, elder care.",
  "active_end_month": "2026-12",
  "recent_statement": "Adcock 2026 public statements reaffirm $20-30K end-state pricing.",
  "watch_events_raw": "Humanoid BOM disclosures; commercial lease/purchase pricing; Tesla Optimus MSRP announcements.",
  "months_from_today": 33,
  "probability_layer": "Medium",
  "active_start_month": "2026-01",
  "december_dispersal": {
    "reason": "december_dispersal: domain=Robotics → 11/2026",
    "new_date": "2026-11-30",
    "old_date": "2026-12-31",
    "applied_at": "2026-04-30T16:28:34.304992+00:00"
  },
  "flag_nia_bracketed": false,
  "track_record_grade": "B",
  "track_record_notes": "Adcock / Figure execution track record: 3 robot generations in 3.5 years; BMW validated. Track record <5y; billion-humanoid claim untestable near-term.",
  "contradicting_notes": "Tesla Optimus targets have slipped repeatedly; industry first-gen pricing typically 2-3x long-run cost.",
  "flag_near_term_2027": false,
  "flag_high_conviction": true,
  "milestones_phase2_at": "2026-05-01T18:30:21.236381+00:00",
  "milestones_derived_at": "2026-05-02T03:08:50.676650+00:00",
  "reference_class_match": {
    "top_n": [
      {