← Cockpit
CMQ_051predictionRoboticshumanoid-TAM

Humanoid robots total addressable market by 2040: lower bound 1 billion units (exceeding cars on Earth); upper bound 10+ billion units.

Predictor: Brett Adcock / Elon Musk / Vinod Khosla

Prior probability
40.0%
Current probability
37.0%
evolves via intake + LBP
Conviction
5/5
Signal quality
A
Resolution
pending
Window
2040-01-01 – 2040-09-30
Edges in / out
4 / 0
Tickers exposed
25

Prediction text

Humanoid robots total addressable market by 2040: lower bound 1 billion units (exceeding cars on Earth); upper bound 10+ billion units. | Humanoid unit-cost curve < $30K; BMW/Mercedes commercial deployments

Key catalyst: Humanoid unit-cost curve < $30K; BMW/Mercedes commercial deployments

Watch events: Figure / Tesla / 1X / Apptronik annual shipment data; humanoid unit-economics trajectory.

Resolution evidence

Status: pending

Figure AI $675M Series B 2024; BMW partnership active; Tesla Optimus V3 targeting 1M+ units/yr by 2030.

Predictor: Brett Adcock / Elon Musk / Vinod Khosla

κ + Brier as of 2026-07-04
κ (discount)
0.500
Brier
Hits / Misses
0 / 0
Hit rate

Evidence about this node from Brett Adcock / Elon Musk / Vinod Khosla is multiplied by κ in /api/intake. Lower κ = less weight; floors at 0.10 (effectively silenced) and caps at 1.00 (full weight).

Reference class: humanoid_commercial_volume

Linked via embedding similarity 0.758

>10,000 unit cumulative deployment of humanoid robot SKU within 3 years of debut

Base rate
10.0%
0/3 historical
Inside weight
Outside weight
no pull
inside 37.0% → blend 37.0% 0.0pp)

Tetlock-style outside view: at TRF=1 (just predicted), outside view dominates (w_in=0.3). At TRF=0 (deadline), inside view dominates (w_in=1.0). The blend regularizes overconfident inside views toward the historical base rate.

Probability over time

5 prob_history rows
0%25%50%75%100%prior 40%2026-04-302026-05-102026-05-24
intake v2milestone miss sweeplbp propagationreference class assignedlegacy v1prior_prob (analyst seed)current = 37.0%

Milestone chain

Pre-event signals (upstream prereqs + window checkpoints) → resolution event → downstream cascades. Status/dates update from linked nodes; re-derive nightly via scripts/ops/derive_milestones.py.
Leading chain: 5 pending
  1. 2040-02-20pendingQ1 window check-in (25%)
  2. 2040-04-10pendingQ2 window check-in (50%)
  3. 2040-05-30pendingQ3 window check-in (75%)

No downstream cascades — this prediction is a leaf in the dependency graph.

What if this resolves?

Clamp this prediction TRUE or FALSE and run a counterfactual Gibbs sample. Surfaces the predictions whose marginals shift most under that assumption.
(live posterior: 37%)

Click a button to clamp this prediction and run a Gibbs sample. Returns the predictions whose marginals shift most. ~30s per run; ideal for stress-testing "if X resolves, what else moves?"

Evidence chain

Every probability update with full Bayesian provenance — chronological, latest first
LBP2026-05-24T02:00:02Z37.0%+1.7pp
Network propagation: 35.2% → 37.0%
4-iter LBP, residual 0.01000 · damping 0.5, w_intrinsic 0.5 · method lbp_v3 · run 806b02f8
LBP2026-05-17T02:00:01Z35.2%+3.4pp
Network propagation: 31.9% → 35.2%
5-iter LBP, residual 0.00689 · damping 0.5, w_intrinsic 0.5 · method lbp_v3 · run e607fa96
LBP2026-05-10T02:00:02Z31.9%+6.2pp
Network propagation: 25.7% → 31.9%
6-iter LBP, residual 0.00584 · damping 0.5, w_intrinsic 0.5 · method lbp_v3 · run e5c18d29
LBP2026-05-03T02:00:01Z25.7%+9.7pp
Network propagation: 16.0% → 25.7%
6-iter LBP, residual 0.00677 · damping 0.5, w_intrinsic 0.5 · method lbp_v3 · run 1a683ac9
legacy v12026-04-30T01:56:50Z16.0%-24.0pp
reference_class_assigned bayesian_v2 inside=0.400 blend=0.160 w_in=0.30 humanoid_commercial_volume

Network propagation neighbors

Top edges sorted by latest LBP cross-impact
All propagation →

No propagation data yet. Run inference/.venv/bin/python scripts/ops/run_loopy_belief_propagation.py on the droplet, or wait for the Sunday 02:00 UTC weekly cron.

Ticker exposure

25 ticker(s) linked

Beneficiaries (22)

LYSCFSYMHSEHYMPALNTSERVRNSHFFANUYIRBTUSARMIELYAMZNBYDDYHYMTFIFNNYABBNYPHTERTSLATXNSTMTEL

Adverse (3)

RHIKFYMAN

Prerequisites (4)

Predictions that must hit first
TypePredTitleDomainLag
correlateS_HUMANOID_ENTERPRISE_2028Humanoid R2: 100K+ enterprise by Nov 2028humanoid_deployment
correlateS_HUMANOID_FACTORY_2026Humanoid R1: 10K+ factory units by Nov 2026humanoid_deployment
correlateS_HUMANOID_CONSUMER_2030Humanoid R3: 1M+ consumer by Nov 2030humanoid_deployment
correlateS_HUMANOID_MASS_2033Humanoid R4: 10M+ cumulative by Dec 2033humanoid_deployment

Dependents (0)

Predictions enabled by this
TypePredTitleDomainLag
No dependents

Linked documents (10)

Auto-generated by cosine similarity from Polymarket / Manifold / EDGAR / GDELT
SimSourceTitleMarket probPolarityReviewedPublished
0.723manifoldWhen will a humanoid robot be capable of driving?mentionspending2026-06-28
0.658arxivIdentification of a Physics-Based Electrical Power Consumption Model for the Unitree G1 Humanoid Armmentionspending2026-06-14
0.621arxivHeight Control and Optimal Torque Planning for Jumping With Wheeled-Bipedal Robotsmentionspending2026-05-05
0.613gdelt1256561.htmlmentionspending2026-04-30
0.590edgar_8kEKSO BIONICS HOLDINGS, INC. (EKSO) (CIK 0001549084)mentionspending2026-05-04
0.584manifoldWhat will be the total prize pool in Manifold Prize Drawings #30-39?mentionspending2026-06-14
0.579edgar_8kServe Robotics Inc. /DE/ (SERV) (CIK 0001832483)mentionspending2026-06-18
0.579edgar_8kServe Robotics Inc. /DE/ (SERV) (CIK 0001832483)mentionspending2026-06-24
0.579edgar_8kServe Robotics Inc. /DE/ (SERV) (CIK 0001832483)mentionspending2026-05-11
0.570edgar_8kRICHTECH ROBOTICS INC. (RR) (CIK 0001963685)mentionspending2026-06-03

Raw metadata

From Thesis_Timeline_v1.0_FINAL workbook
{
  "nia": false,
  "qty": "1-10B+ units",
  "mode": "FORECAST",
  "role": "Guest-CEO",
  "caveats": "TAM sensitive to price-point curve, labor-substitution pace, regulatory regime.",
  "context": "Adcock synthesis of industry-leader predictions; implies humanoid market dwarfs automotive by orders of magnitude.",
  "to_year": 2040,
  "conv_cues": "range with lower+upper; industry consensus",
  "direction": "NUMERIC_TARGET",
  "from_year": 2040,
  "timeframe": "by 2040",
  "conv_level": "HIGH",
  "milestones": [
    {
      "kind": "scenario_signal",
      "label": "Scenario fires: Humanoid R3: 1M+ consumer by Nov 2030",
      "status": "pending",
      "weight": 0.7,
      "ordinal": -5,
      "source_id": "S_HUMANOID_CONSUMER_2030",
      "expected_date": "2030-11-30",
      "observed_date": null
    },
    {
      "kind": "scenario_signal",
      "label": "Scenario fires: Humanoid R4: 10M+ cumulative by Dec 2033",
      "status": "pending",
      "weight": 0.7,
      "ordinal": -4,
      "source_id": "S_HUMANOID_MASS_2033",
      "expected_date": "2033-12-31",
      "observed_date": null
    },
    {
      "kind": "quartile_checkpoint",
      "label": "Q1 window check-in (25%)",
      "status": "pending",
      "weight": 0.05,
      "ordinal": -3,
      "source_id": null,
      "expected_date": "2040-02-20",
      "observed_date": null
    },
    {
      "kind": "quartile_checkpoint",
      "label": "Q2 window check-in (50%)",
      "status": "pending",
      "weight": 0.05,
      "ordinal": -2,
      "source_id": null,
      "expected_date": "2040-04-10",
      "observed_date": null
    },
    {
      "kind": "quartile_checkpoint",
      "label": "Q3 window check-in (75%)",
      "status": "pending",
      "weight": 0.05,
      "ordinal": -1,
      "source_id": null,
      "expected_date": "2040-05-30",
      "observed_date": null
    },
    {
      "kind": "event",
      "label": "Humanoid robots total addressable market by 2040: lower bound 1 billion units (exceeding cars on Earth); upper bound 10+ billion units.",
      "status": "pending",
      "weight": 1,
      "ordinal": 0,
      "source_id": "CMQ_051",
      "expected_date": "2040-07-20",
      "observed_date": null
    }
  ],
  "repeat_eps": 1,
  "affiliation": "Figure AI / Tesla / Khosla Ventures",
  "attribution": "FIRST_PERSON",
  "granularity": "YEAR",
  "source_refs": "36",
  "target_date": "2040-01-15T00:00:00",
  "display_date": "2040-07-20",
  "episode_date": "2026-04-21T00:00:00",
  "key_catalyst": "Humanoid unit-cost curve < $30K; BMW/Mercedes commercial deployments",
  "parse_method": "Report midpoint",
  "domain_bucket": "Robotics",
  "episode_title": "The Global Architecture of Machine Intelligence: Exhaustive Synthesis of AI Compute, Memory & Quantum Predictions (2023-2026)",
  "fault_line_id": "F005",
  "flag_repeated": false,
  "in_5yr_window": false,
  "source_report": "AI_Chip__Compute__Memory__Quantum_Predictions.md (2026-04-21)",
  "appears_in_eps": "CMQ-RPT",
  "futurist_phase": "Phase 3 (2029-2030)",
  "is_macro_claim": false,
  "total_mentions": 1,
  "priority_weight": 4,
  "ps_cluster_tags": [
    "C8"
  ],
  "report_evidence": "1B-10B humanoid TAM = largest single new manufactured category in history if realized.",
  "active_end_month": "2040-12",
  "recent_statement": "Adcock 2026 interviews; Musk Optimus comments continue to reinforce billion-unit range.",
  "watch_events_raw": "Figure / Tesla / 1X / Apptronik annual shipment data; humanoid unit-economics trajectory.",
  "months_from_today": 165,
  "probability_layer": "Lower (long-tail)",
  "active_start_month": "2040-01",
  "december_dispersal": {
    "reason": "december_dispersal: domain=Robotics → 09/2040",
    "new_date": "2040-09-30",
    "old_date": "2040-12-31",
    "applied_at": "2026-04-30T16:28:34.304992+00:00"
  },
  "flag_nia_bracketed": false,
  "track_record_grade": "B",
  "track_record_notes": "Long-dated TAM estimates unfalsifiable in near term; directional consensus of 
... (truncated)